Beta-Amyloid 1-40 is a primary protein in plaques found in the brains of patients with Alzheimer's disease.	
	
	
		
			Beta-Amyloid 1-40(Human) 
| 
 |  | 
 | 
|  |  | Cat No. | Size | Price (USD) | Delivery time | 
|  |  | A-40-T-1 | 1 mg | $125.00 | 1~2 days | 
|  |  | A-40-T-5 | 5 mg | $400.00 | 1~2 days | 
|  |  | A-40-T-10 | 10 mg | $700.00 | 1~2 days | 
| 
 | 
|  | Purity: | >95% | 
|  | Sequence: | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV | 
|  |  | Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile- 
		Gly-Leu-Met-Val-Gly-Gly-Val-Val | 
|  | CAS No.: | 131438-79-4 | 
|  | Formula: | C194H295N530O58S1 | 
|  | Molecular 
		Weight: | 4329.90 | 
|  | Appearance: | Lyophilized white 
		powder | 
|  | Counter Ion: | TFA | 
|  | Storage: | Power: -20°C(1 
		year)  or -80°C(1~2 years) ; In solvent: -20°C(1 month)  or -80°C(5~6 
		months) | 
|  | Reconstitution: | Water | 
|  | Shipping: | All peptides will 
		be shipped as lyophilized powder with desiccant at room temperature. | 
Selected Publications using GenicBio's Beta amyloid peptides:



................................................................