Beta-Amyloid 1-40(Human)

Beta-Amyloid 1-40 is a primary protein in plaques found in the brains of patients with Alzheimer's disease.

Beta-Amyloid 1-42(Human)

Beta-Amyloid 1-42 human is a 42-amino acid peptide which plays a key role in the pathogenesis of Alzheimer disease.

Beta-Amyloid 1-42(Human), HFIP-treated

The peptide has been treated with HFIP.

Beta-Amyloid 1-40, HCl

Beta-Amyloid 1-40 is prepared and provided in the form of HCl salt.

Beta-Amyloid 1-42, Scrambled

AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA