Tel: +86-021-3762 1270
Fax: +86-021-6762 1877
Email: service@genicbio.com
Beta-Amyloid 1-40(Human)
2320
Beta-Amyloid 1-40 is a primary protein in plaques found in the brains of patients with Alzheimer's disease.
Beta-Amyloid 1-42(Human)
3091
Beta-Amyloid 1-42 human is a 42-amino acid peptide which plays a key role in the pathogenesis of Alzheimer disease.
Beta-Amyloid 1-42(Human), HFIP-treated
3137
The peptide has been treated with HFIP.
Beta-Amyloid 1-40, HCl
2041
Beta-Amyloid 1-40 is prepared and provided in the form of HCl salt.
Beta-Amyloid 1-42, Scrambled
2196
AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA